PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn064521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 611aa    MW: 69481.9 Da    PI: 5.0072
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn064521genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.83.7e-26351404155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr+ Wt eLH++Fv av+q+ G ++A+Pk+il++m+ +g+t+e+v+SHLQkYR 
  Achn064521 351 KPRMIWTAELHQKFVAAVDQI-GLKNAVPKKILDVMNFPGITRENVASHLQKYRN 404
                 79*******************.9*******************************6 PP

2Response_reg65.82e-221712771107
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+ + + ll+++l + +y +v++++ + eal +l++ +  +D+++  + +p+mdG++ll+ i  e  +lp++++++ +e+  + +++  Ga 
    Achn064521 171 VLAVDDDSNYLTLLTSMLHDCRY-KVTTCSRANEALSILRQGKsnFDIVISEVHIPDMDGFQLLEIICLEM-DLPVVMMSSDDENGVVFKCIMDGAC 265
                   799********************.***************888888**********************8865.9************************ PP

                   EEEESS--HHHH CS
  Response_reg  96 dflsKpfdpeel 107
                   d+l+Kp+ +e++
    Achn064521 266 DYLVKPVRMEDI 277
                   *******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.7E-30168288IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.6E-35168323No hitNo description
SMARTSM004482.7E-22169281IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011036.54170285IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.6E-19171277IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.12E-22172285No hitNo description
SuperFamilySSF466891.42E-18349408IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-26350408IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-22351404IPR006447Myb domain, plants
PfamPF002492.2E-6354403IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MKGKNVIQYF PLTASSSFLI HIDGVITTLG RTQPEIRLTQ GTQEASLTYV PTVWIAQPHP  60
YNPILARQWL FTLLLHLPQC VAVTGGYDGL DLEMNLNENI PRSEVDESGD VILLASIAMA  120
TNFKHIPNFF EKNKKKEEED VVRLFIILNL MGMIKSNESS SVFEFPAGLR VLAVDDDSNY  180
LTLLTSMLHD CRYKVTTCSR ANEALSILRQ GKSNFDIVIS EVHIPDMDGF QLLEIICLEM  240
DLPVVMMSSD DENGVVFKCI MDGACDYLVK PVRMEDIKFL WKHVIRKQKN GGVRVLEESK  300
NVDDVDILLH QNQVKNVENV SIDNENHESS NYVTEEEEEG KEKDDSVSLK KPRMIWTAEL  360
HQKFVAAVDQ IGLKNAVPKK ILDVMNFPGI TRENVASHLQ KYRNYIRRVD ENLQNQCNFN  420
KLPMHPQEKN PELIAHFPSY NLHNQVTFIQ PTQRSYANFS NYTPLVNQNN FYNYGMLESG  480
FGIGSEQLSN SSIGADLSPE VSTTMESDQP MSINDFFQAS GERYLDRFNP PVNVNRIHGN  540
LTSSFIMQRP FKMQRLNENK STEVFTDGAV YHPVSLSPPE LYVEQFDHED VNIRPYNEVS  600
SCVYVSSIKI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-21350409463ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32902038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.14e-85response regulator 2